General Information

  • ID:  hor000994
  • Uniprot ID:  P01352
  • Protein name:  Gastrin
  • Gene name:  GAST
  • Organism:  Bos taurus (Bovine)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QGPWVEEEEAAYGWMDF
  • Length:  17(76-92)
  • Propeptide:  MQRLCAHVLILVLALAAFCEASWKPHSHLQDAPVAPGANRGQEPLRMNRLGPASNPRRQLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDFGRRSAEEGDQHP
  • Signal peptide:  MQRLCAHVLILVLALAAFCEA
  • Modification:  T1 Pyrrolidone carboxylic acid;T12 Sulfotyrosine;T17 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR
  • Target Unid:   P79266
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01352-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000994_AF2.pdbhor000994_ESM.pdb

Physical Information

Mass: 232975 Formula: C94H122N20O30S
Absent amino acids: CHIKLNRST Common amino acids: E
pI: 3.26 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 6
Hydrophobicity: -82.35 Boman Index: -2211
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 28.82
Instability Index: 7201.18 Extinction Coefficient cystines: 12490
Absorbance 280nm: 780.63

Literature

  • PubMed ID:  5665711
  • Title:  Isolation, Structure and Synthesis of Ovine and Bovine Gastrins